PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G49620.2
Common NameAtMYB78, MYB78
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 321aa    MW: 37114.3 Da    PI: 5.0004
Description myb domain protein 78
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G49620.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-172875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+ l+++++ +G g+W++ ar+  ++Rt+k+c++rw++yl
      AT5G49620.2 28 RGPWTVEEDLELINYIASHGEGRWNSLARCAELKRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding45.91.3e-1481138146
                      TSSS-HHHHHHHHHHHHHTTTT.............-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.............tWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l++++++++G+              +W++Ia++++ gRt++++k++w++
      AT5G49620.2  81 RGNITLEEQLLILELHTRWGNSnefdhkfssscedRWSKIAQYLP-GRTDNEIKNYWRT 138
                      7999****************99***********************.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.8032379IPR017930Myb domain
SuperFamilySSF466898.78E-2625136IPR009057Homeodomain-like
SMARTSM007175.0E-152777IPR001005SANT/Myb domain
PfamPF002499.1E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-222982IPR009057Homeodomain-like
CDDcd001672.83E-113075No hitNo description
PROSITE profilePS5129411.2780144IPR017930Myb domain
SMARTSM007172.9E-1080142IPR001005SANT/Myb domain
PfamPF002493.0E-1281138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1983143IPR009057Homeodomain-like
CDDcd001672.23E-6114138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGDKGRSLKI NKNMEEFTKV EEEMDVRRGP WTVEEDLELI NYIASHGEGR WNSLARCAEL  60
KRTGKSCRLR WLNYLRPDVR RGNITLEEQL LILELHTRWG NSNEFDHKFS SSCEDRWSKI  120
AQYLPGRTDN EIKNYWRTRV QKHAKQLKCD VNSQQFKDTM KYLWMPRLVE RIQAASIGSV  180
SMSSCVTTSS DQFVINNNNT NNVDNLALMS NPNGYITPDN SSVAVSPVSD LTECQVSSEV  240
WKIGQDENLV DPKMTSPNYM DNSSGLLNGD FTKMQDQSDL NWFENINGMV PNYSDSFWNI  300
GNDEDFWLLQ QHQQVHDNGS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-212513624120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248618_at0.0
Expression AtlasAT5G49620-
AtGenExpressAT5G49620-
ATTED-IIAT5G49620-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G49620.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G49620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0230330.0AB023033.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone: K6M13.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190502.10.0myb domain protein 78
SwissprotQ9LDE11e-119MY108_ARATH; Transcription factor MYB108
TrEMBLF4K6660.0F4K666_ARATH; Myb domain protein 78
STRINGAT5G49620.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Mengiste T,Chen X,Salmeron J,Dietrich R
    The BOTRYTIS SUSCEPTIBLE1 gene encodes an R2R3MYB transcription factor protein that is required for biotic and abiotic stress responses in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2551-65
    [PMID:14555693]
  4. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  5. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]